PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_82197g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 329aa    MW: 37260.4 Da    PI: 5.6627
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_82197g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv +++++G+g+W++I+++ g+ R+ k+c++rw +yl
    MA_82197g0010 14 KGPWTPEEDIALVSYIQEHGPGNWRLIPARTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding47.54e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ Ed +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
    MA_82197g0010  67 RGNFTPYEDRIIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.09965IPR017930Myb domain
SuperFamilySSF466891.43E-3111108IPR009057Homeodomain-like
SMARTSM007174.0E-151363IPR001005SANT/Myb domain
PfamPF002491.5E-161461IPR001005SANT/Myb domain
CDDcd001676.08E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129420.03166116IPR017930Myb domain
SMARTSM007174.3E-1466114IPR001005SANT/Myb domain
PfamPF002495.0E-1467112IPR001005SANT/Myb domain
CDDcd001672.98E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRSPCCDKV GVKKGPWTPE EDIALVSYIQ EHGPGNWRLI PARTGLLRCS KSCRLRWTNY  60
LRPGIRRGNF TPYEDRIIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKRLTKLE  120
TMIAGNELNR DSIIRSSFSS DDYRSSKGQW ETKLQTDIHR AKKALFEALN MQGPSSSLQG  180
GGTTSDSMWM ERNPNSSYAV SVENLSKLLE GWKQSSPNER KPASIMINPL EGNQYQSSQY  240
SAEVPISHDS EIEGLHDVDN GSLAWASSFN SSQDYGDDGG SLHDFDLCQM DSYQNTMDNN  300
LPFSVLESWL MEETNQDQFG YNVSELQSV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1005800.0BT100580.1 Picea glauca clone GQ0026_G03 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258354.11e-108PREDICTED: myb-related protein 306
SwissprotP813922e-97MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D6R8Q91e-136A0A0D6R8Q9_ARACU; Uncharacterized protein
STRINGVIT_14s0108g00830.t011e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.19e-91myb domain protein 31